Entry Information
Protein Name GatZ
Accession No P37191
Protein description Putative tagatose 6-phosphate kinase gatZ
pI/Mw (Da)
Theoretical Experimental
5.5/47108.72 5.43/50756
Protein function and expression The gatYZ encodes tagatose-1,6-bisphosphate aldolase 2, which is a part of the galactitol catabolism pathway.
Reference(s) Champion, K. M., J. C. Nishihara, J. C. Joly, and D. Arnott. 2001. Similarity of the Escherichia coli proteome upon completion of different biopharmaceutical fermentation processes. Proteomics 1:1133-1148. (NCBI)

2D gels information
Map ID38
Reference(s)Champion, K. M., J. C. Nishihara, J. C. Joly, and D. Arnott. 2001. Similarity of the Escherichia coli proteome upon completion of different biopharmaceutical fermentation processes. Proteomics 1:1133-1148. (NCBI)
Protein function and expression(s)Map: A
pI/Mw: 5.43/50756

A
2-DE profile of E. coli proteins at the end of anti-CD18 blank run fermentation.
Swiss-Prot Database Reference

Entry information
Entry Name GATZ_ECOLI
Primary accession number P37191
Secondary accession numbers P76414 
Integrated into Swiss-Prot on 1994-10-01
Sequence was last modified on 1997-11-01 (Sequence version 2)
Annotations were last modified on 2006-09-05 (Entry version 47)
Name and origin of the protein
Protein name Putative tagatose 6-phosphate kinase gatZ
Synonyms EC 2.7.1.144 Putative tagatose 6-phosphate kinase gatZ
Gene name Name : gatZ
OrderedLocusName : b2095
From Escherichia coli [TaxID:562] [HAMAP proteome]
Taxonomy Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Escherichia;
References
[1] NUCLEOTIDE SEQUENCE [GENOMIC DNA].
strain = EC3132
DOI=10.1016/0167-4781(95)00053-J;PubMed=7772602[NCBI, ExPASy, EBI, Israel, Japan]
Nobelmann B. , Lengeler J.W. ,
"Sequence of the gat operon for galactitol utilization from a wild-type strain EC3132 of Escherichia coli."
Biochim. Biophys. Acta1262:69-72(1995) 
[2] NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
strain = K12 / W3110 / ATCC 27325 / DSM 5911
DOI=10.1093/dnares/3.6.379;PubMed=9097040[NCBI, ExPASy, EBI, Israel, Japan]
Itoh T. , Aiba H. , Baba T. , Fujita K. , Hayashi K. , Inada T. , Isono K. , Kasai H. , Kimura S. , Kitakawa M. , Kitagawa M. , Makino K. , Miki T. , Mizobuchi K. , Mori H. , Mori T. , Motomura K. , Nakade S. , Nakamura Y. , Nashimoto H. , Nishio Y. , Oshima T. , Saito N. , Sampei G. , Seki Y. , Sivasundaram S. , Tagami H. , Takeda J. , Takemoto K. , Wada C. , Yamamoto Y. , Horiuchi T. ,
"A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map."
DNA Res.3:379-392(1996) 
[3] NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
strain = K12 / MG1655 / ATCC 47076
DOI=10.1126/science.277.5331.1453;PubMed=9278503[NCBI, ExPASy, EBI, Israel, Japan]
Blattner F.R. , Plunkett G. III , Bloch C.A. , Perna N.T. , Burland V. , Riley M. , Collado-Vides J. , Glasner J.D. , Rode C.K. , Mayhew G.F. , Gregor J. , Davis N.W. , Kirkpatrick H.A. , Goeden M.A. , Rose D.J. , Mau B. , Shao Y. ,
"The complete genome sequence of Escherichia coli K-12."
Science277:1453-1474(1997) 
[4] NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
strain = K12 / W3110 / ATCC 27325 / DSM 5911
DOI=10.1038/msb4100049;
Hayashi K. , Morooka N. , Yamamoto Y. , Fujita K. , Isono K. , Choi S. , Ohtsubo E. , Baba T. , Wanner B.L. , Mori H. , Horiuchi T. ,
"Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110."
Mol. Syst. Biol.2:E1-E5(2006) 
Comments
  • CATALYTIC ACTIVITY : ATP + D-tagatose 6-phosphate = ADP + D-tagatose 1,6-bisphosphate
  • PATHWAY : Galacticol utilization
  • SIMILARITY : To E.coli agaZ
  • Copyright
    Copyrighted by the UniProt Consortium, see http://www.uniprot.org/. Distributed under the Creative Commons Attribution-NoDerivs License.
    Cross-reference
    Sequence databases
    EMBL X79837;CAA56227.1;-;Genomic_DNA [EMBL/GenBank/DDBJ][CoDingSequence].
    U00096;AAC75156.1;-;Genomic_DNA [EMBL/GenBank/DDBJ][CoDingSequence].
    AP009048;BAA15965.1;-;Genomic_DNA [EMBL/GenBank/DDBJ][CoDingSequence].
    PIR F64976;F64976.
    S55902;S55902.
    3D structure databases
    PDB 2FIQ;X-ray;A/B/C/D=1-420[ExPASy/RCSB/EBI].
    Detailed list of linked structures
    ModBase P37191
    Protein-protein interaction databases
    IntAct P37191;-.
    DIP P37191
    Enzyme and pathway databases
    BioCyc EcoCyc:G7128-MONOMER;-.
    2D gel databases
    SWISS-2DPAGE Get region on 2D PAGE
    Organism-specific gene databases
    EchoBASE EB2317;-.
    EcoGene EG12418;gatZ.
    HOGENOM [Family / Alignment / Tree]
    Family and domain databases
    InterPro IPR012062;TagBP_ald_AgaZ.
    Graphical view of domain structure
    Pfam PF08013;Tagatose_6_P_K;1.
    Pfam graphical view of domain structure
    PIRSF PIRSF009264;TagBP_ald_AgaZ;1.
    BLOCKS P37191
    Genome annotation databases
    GenomeReviews U00096_GR;b2095.
    Other
    ProtoNet P37191
    UniRef View cluster of proteins with at least 50% / 90% / 100% identity
    Keyword
    3D-structure; Complete proteome; Galactitol metabolism; Kinase; Transferase;
    Features
    Feature table viewer Feature aligner
    Key  From   To Length  Description  FTId
    CHAIN    1   420    420  Putative tagatose 6-phosphate kinase gatZ  PRO_0000087433
    CONFLICT  112   112    E -> A: (in Ref. 1)  
    CONFLICT  189   189    H -> R: (in Ref. 1)  
    CONFLICT  210   210    T -> A: (in Ref. 1)  
    CONFLICT  320   320    L -> F: (in Ref. 1)  
    CONFLICT  372   420    VDIPLGMISQYLPKQFERIQSGELSAIPHQLIMDKIYDVLRAYRYGCAE -> MEILWHD: (in Ref. 1)  
    Sequence information
    Length: 420AA [This is the length of the unprocessed precursor] Molecular weight: 47109Da [This is the MW of the unprocessed precursor] CRC64: 258D25D832E42580[This is a checksum on the sequence]
            10         20         30         40         50         60
    MKTLIARHKA GEHIGICSVC SAHPLVIEAA LAFDRNSTRK VLIEATSNQV NQFGGYTGMT
            70         80         90        100        110        120
    PADFREFVFT IADKVGFARE RIILGGDHLG PNCWQQENAD AAMEKSVELV KEYVRAGFSK
           130        140        150        160        170        180
    IHLDASMSCA GDPIPLAPET VAERAAVLCF AAESVATDCQ REQLSYVIGT EVPVPGGEAS
           190        200        210        220        230        240
    AIQSVHITHV EDAANTLRTH QKAFIARGLT EALTRVIAIV VQPGVEFDHS NIIHYQPQEA
           250        260        270        280        290        300
    QPLAQWIENT RMVYEAHSTD YQTRTAYWEL VRDHFAILKV GPALTFALRE AIFALAQIEQ
           310        320        330        340        350        360
    ELIAPENRSG CLAVIEEVML DEPQYWKKYY RTGFNDSLLD IRYSLSDRIR YYWPHSRIKN
           370        380        390        400        410        420
    SVETMMVNLE GVDIPLGMIS QYLPKQFERI QSGELSAIPH QLIMDKIYDV LRAYRYGCAE
    
    
    P37191 in FASTA format